Lineage for d2bcva1 (2bcv A:253-328)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493774Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1493989Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 1493990Protein automated matches [254482] (2 species)
    not a true protein
  7. 1493991Species Human (Homo sapiens) [TaxId:9606] [255046] (4 PDB entries)
  8. 1493993Domain d2bcva1: 2bcv A:253-328 [128316]
    Other proteins in same PDB: d2bcva2, d2bcva3
    automated match to d1rzta1
    protein/DNA complex; complexed with mg, na, ttp

Details for d2bcva1

PDB Entry: 2bcv (more details), 2 Å

PDB Description: DNA polymerase lambda in complex with Dttp and a DNA duplex containing an unpaired Dtmp
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcva1 a.60.6.0 (A:253-328) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmaek
iieilesghlrkldhi

SCOPe Domain Coordinates for d2bcva1:

Click to download the PDB-style file with coordinates for d2bcva1.
(The format of our PDB-style files is described here.)

Timeline for d2bcva1: