Class a: All alpha proteins [46456] (285 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Domain d2bcua2: 2bcu A:329-385 [128314] Other proteins in same PDB: d2bcua1, d2bcua3 automated match to d2pfna2 protein/DNA complex; complexed with na, ppv |
PDB Entry: 2bcu (more details), 2.2 Å
SCOPe Domain Sequences for d2bcua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcua2 a.60.12.0 (A:329-385) automated matches {Human (Homo sapiens) [TaxId: 9606]} sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d2bcua2: