Lineage for d2bcsa1 (2bcs A:252-327)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643019Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 643020Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 643140Protein DNA polymerase lambda [101251] (1 species)
  7. 643141Species Human (Homo sapiens) [TaxId:9606] [101252] (15 PDB entries)
  8. 643154Domain d2bcsa1: 2bcs A:252-327 [128310]
    Other proteins in same PDB: d2bcsa2, d2bcsa3
    automatically matched to d1nzpa_
    complexed with mg, na, ppv

Details for d2bcsa1

PDB Entry: 2bcs (more details), 2.2 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Dcmp
PDB Compounds: (A:) DNA polymerase lambda

SCOP Domain Sequences for d2bcsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcsa1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
kiieilesghlrkldh

SCOP Domain Coordinates for d2bcsa1:

Click to download the PDB-style file with coordinates for d2bcsa1.
(The format of our PDB-style files is described here.)

Timeline for d2bcsa1: