Lineage for d2bcra2 (2bcr A:329-385)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494216Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. Protein automated matches [254483] (3 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255047] (4 PDB entries)
  8. 1494458Domain d2bcra2: 2bcr A:329-385 [128308]
    Other proteins in same PDB: d2bcra1, d2bcra3
    automated match to d2bcqa2
    protein/DNA complex; complexed with edo, mg, na, ppv

Details for d2bcra2

PDB Entry: 2bcr (more details), 1.75 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Damp
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcra2 a.60.12.0 (A:329-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d2bcra2:

Click to download the PDB-style file with coordinates for d2bcra2.
(The format of our PDB-style files is described here.)

Timeline for d2bcra2: