Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain |
Protein DNA polymerase lambda [101253] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101254] (16 PDB entries) |
Domain d2bcra2: 2bcr A:329-385 [128308] Other proteins in same PDB: d2bcra1, d2bcra3 automatically matched to d1rzta2 complexed with edo, mg, na, ppv |
PDB Entry: 2bcr (more details), 1.75 Å
SCOP Domain Sequences for d2bcra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcra2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d2bcra2: