| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
| Protein automated matches [254482] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255046] (5 PDB entries) |
| Domain d2bcra1: 2bcr A:251-328 [128307] Other proteins in same PDB: d2bcra2, d2bcra3 automated match to d1rzta1 protein/DNA complex; complexed with edo, mg, na, ppv |
PDB Entry: 2bcr (more details), 1.75 Å
SCOPe Domain Sequences for d2bcra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcra1 a.60.6.0 (A:251-328) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrma
ekiieilesghlrkldhi
Timeline for d2bcra1: