Lineage for d2bcqa2 (2bcq A:329-385)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 771412Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 771413Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 771545Protein DNA polymerase lambda [101253] (1 species)
  7. 771546Species Human (Homo sapiens) [TaxId:9606] [101254] (16 PDB entries)
  8. 771547Domain d2bcqa2: 2bcq A:329-385 [128305]
    Other proteins in same PDB: d2bcqa1, d2bcqa3
    automatically matched to d1rzta2
    complexed with edo, mg, na, ppv

Details for d2bcqa2

PDB Entry: 2bcq (more details), 1.65 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Dtmp
PDB Compounds: (A:) DNA polymerase lambda

SCOP Domain Sequences for d2bcqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOP Domain Coordinates for d2bcqa2:

Click to download the PDB-style file with coordinates for d2bcqa2.
(The format of our PDB-style files is described here.)

Timeline for d2bcqa2: