SCOP 1.73: Domain d2bcnb1: 2bcn B:1-108

Lineage for d2bcnb1 (2bcn B:1-108)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (39 PDB entries)

8. Domain d2bcnb1: 2bcn B:1-108 [128300]
   Other proteins in same PDB: d2bcna1, d2bcnc1
   automatically matched to d1u74b_
   complexed with hem, znh; mutant

Details for d2bcnb1

PDB Entry: 2bcn, 1.7 Å

PDB Description: solvent isotope effects on interfacial protein electron transfer between cytochrome c and cytochrome c peroxidase

PDB Compounds: (B:) Cytochrome c iso-1

SCOP Domain Sequences for d2bcnb1:

Sequence; same for both SEQRES and ATOM records:

>d2bcnb1 a.3.1.1 (B:1-108) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase

Timeline for d2bcnb1:

• d2bcnb1 is new in SCOP 1.73
  
• d2bcnb1 appears in SCOP 1.75
  
• d2bcnb1 appears in the current release, SCOPe 2.08, called d2bcnb_