Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) [50747] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [89354] (3 PDB entries) |
Domain d2bcja2: 2bcj A:550-656 [128287] Other proteins in same PDB: d2bcja1, d2bcja3, d2bcjb1, d2bcjg1, d2bcjq1, d2bcjq2 automatically matched to d1omwa2 complexed with alf, gdp, mg |
PDB Entry: 2bcj (more details), 3.06 Å
SCOPe Domain Sequences for d2bcja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcja2 b.55.1.1 (A:550-656) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqq
Timeline for d2bcja2:
View in 3D Domains from other chains: (mouse over for more information) d2bcjb1, d2bcjg1, d2bcjq1, d2bcjq2 |