SCOP 1.73: Domain d2bc3b1: 2bc3 B:14-135

Lineage for d2bc3b1 (2bc3 B:14-135)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)

8. Domain d2bc3b1: 2bc3 B:14-135 [128280]
   automatically matched to d1hy2a_
   complexed with gol, so4

Details for d2bc3b1

PDB Entry: 2bc3, 1.54 Å

PDB Description: t7-tagged full-length streptavidin

PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d2bc3b1:

Sequence, based on SEQRES records:

>d2bc3b1 b.61.1.1 (B:14-135) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
kp

Sequence, based on observed residues (ATOM records):

>d2bc3b1 b.61.1.1 (B:14-135) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesanaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

Timeline for d2bc3b1:

• d2bc3b1 is new in SCOP 1.73
  
• d2bc3b1 appears in SCOP 1.75
  
• d2bc3b1 appears in the current release, SCOPe 2.08, called d2bc3b_