SCOP 1.75: Domain d2baxa1: 2bax A:1-123

Lineage for d2baxa1 (2bax A:1-123)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Phospholipase A2 [48637] (4 species)

7. Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (26 PDB entries)
   Uniprot P00593

8. Domain d2baxa1: 2bax A:1-123 [128250]
   automatically matched to d1c74a_
   complexed with ca, cl, mpd, mrd; mutant

Details for d2baxa1

PDB Entry: 2bax, 1.1 Å

PDB Description: atomic resolution structure of the double mutant (k53,56m) of bovine pancreatic phospholipase a2

PDB Compounds: (A:) phospholipase a2

SCOP Domain Sequences for d2baxa1:

Sequence; same for both SEQRES and ATOM records:

>d2baxa1 a.133.1.2 (A:1-123) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
knc

Timeline for d2baxa1:

• d2baxa1 first appeared in SCOP 1.73
  
• d2baxa1 is called d2baxa_ in SCOPe 2.01
  
• d2baxa1 appears in the current release, SCOPe 2.08, called d2baxa_