SCOPe 2.02: Domain d2basb1: 2bas B:2-262

Lineage for d2basb1 (2bas B:2-262)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.33: EAL domain-like [141868] (1 family)
   variant of the beta/alpha-barrel fold with strand 1 being antiparallel to the rest

5. Family c.1.33.1: EAL domain [141869] (1 protein)
   Pfam PF00563

6. Protein Hypothetical protein YkuI, N-terminal domain [141870] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [141871] (1 PDB entry)
   Uniprot O35014 2-262

8. Domain d2basb1: 2bas B:2-262 [128246]
   Other proteins in same PDB: d2basa2, d2basb2
   automatically matched to 2BAS A:2-262
   complexed with bme

Details for d2basb1

PDB Entry: 2bas, 2.61 Å

PDB Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain.

PDB Compounds: (B:) YkuI protein

SCOPe Domain Sequences for d2basb1:

Sequence, based on SEQRES records:

>d2basb1 c.1.33.1 (B:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk
levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl
eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalkv
sqpspsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetfl
erdvlkqrlktefhqfithek

Sequence, based on observed residues (ATOM records):

>d2basb1 c.1.33.1 (B:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk
levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl
eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalks
psyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerdv
lkqrlktefhqfithek

Timeline for d2basb1:

• d2basb1 first appeared in SCOP 1.73
  
• d2basb1 appears in SCOPe 2.01
  
• d2basb1 appears in SCOPe 2.03
  
• d2basb1 appears in the current release, SCOPe 2.08