![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.33: EAL domain-like [141868] (1 family) ![]() variant of the beta/alpha-barrel fold with strand 1 being antiparallel to the rest |
![]() | Family c.1.33.1: EAL domain [141869] (1 protein) Pfam PF00563 |
![]() | Protein Hypothetical protein YkuI, N-terminal domain [141870] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141871] (1 PDB entry) |
![]() | Domain d2basb1: 2bas B:2-262 [128246] Other proteins in same PDB: d2basa2, d2basb2 automatically matched to 2BAS A:2-262 complexed with bme |
PDB Entry: 2bas (more details), 2.61 Å
SCOP Domain Sequences for d2basb1:
Sequence, based on SEQRES records: (download)
>d2basb1 c.1.33.1 (B:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]} ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalkv sqpspsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetfl erdvlkqrlktefhqfithek
>d2basb1 c.1.33.1 (B:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]} ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalks psyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerdv lkqrlktefhqfithek
Timeline for d2basb1: