SCOPe 2.04: Domain d2banb_: 2ban B:

Lineage for d2banb_ (2ban B:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (5 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [186967] (6 PDB entries)

8. Domain d2banb_: 2ban B: [128241]
   Other proteins in same PDB: d2bana1, d2bana2
   automated match to d1bqmb_
   complexed with 357, mn

Details for d2banb_

PDB Entry: 2ban, 2.95 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r157208

PDB Compounds: (B:) Reverse transcriptase P51 SUBUNIT

SCOPe Domain Sequences for d2banb_:

Sequence; same for both SEQRES and ATOM records:

>d2banb_ e.8.1.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

Timeline for d2banb_:

• d2banb_ first appeared in SCOP 1.73, called d2banb1
  
• d2banb_ appears in SCOPe 2.03
  
• d2banb_ appears in SCOPe 2.05
  
• d2banb_ appears in the current release, SCOPe 2.08