SCOPe 2.06: Domain d2ba2a1: 2ba2 A:5-85

Lineage for d2ba2a1 (2ba2 A:5-85)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.30: MPN010-like [144266] (1 family)
   segmented trimeric coiled coil

5. Family h.1.30.1: MPN010-like [144267] (1 protein)
   Pfam PF01519; DUF16

6. Protein Hypothetical protein MPN010 [144268] (1 species)

7. Species Mycoplasma pneumoniae [TaxId:2104] [144269] (1 PDB entry)
   Uniprot P75103 50-130

8. Domain d2ba2a1: 2ba2 A:5-85 [128233]

Details for d2ba2a1

PDB Entry: 2ba2, 1.8 Å

PDB Description: Crystal structure of the DUF16 domain of MPN010 from Mycoplasma pneumoniae

PDB Compounds: (A:) Hypothetical UPF0134 protein MPN010

SCOPe Domain Sequences for d2ba2a1:

Sequence; same for both SEQRES and ATOM records:

>d2ba2a1 h.1.30.1 (A:5-85) Hypothetical protein MPN010 {Mycoplasma pneumoniae [TaxId: 2104]}
gtryvthkqldeklknfvtktefkefqtvvmesfavqnqnidaqgeqikelqveqkaqgk
tlqlilealqginkrldnles

Timeline for d2ba2a1:

• d2ba2a1 first appeared in SCOP 1.73
  
• d2ba2a1 appears in SCOPe 2.05
  
• d2ba2a1 appears in SCOPe 2.07
  
• d2ba2a1 appears in the current release, SCOPe 2.08