Lineage for d2b9pn1 (2b9p N:4-141)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114518Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2114519Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2114520Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2114521Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2114602Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries)
    Uniprot P60488 1-139
  8. 2114616Domain d2b9pn1: 2b9p N:4-141 [128192]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9pn1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (N:) 50S ribosomal protein L13

SCOPe Domain Sequences for d2b9pn1:

Sequence, based on SEQRES records: (download)

>d2b9pn1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlga

Sequence, based on observed residues (ATOM records): (download)

>d2b9pn1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlpkkqrgreafesvrvylgnpydtlgeisetlga

SCOPe Domain Coordinates for d2b9pn1:

Click to download the PDB-style file with coordinates for d2b9pn1.
(The format of our PDB-style files is described here.)

Timeline for d2b9pn1: