Lineage for d2b9pk1 (2b9p K:71-140)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308802Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2308803Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2308804Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2308895Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
    Uniprot P36238 70-139! Uniprot P36238 71-137
  8. 2308915Domain d2b9pk1: 2b9p K:71-140 [128190]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9pk1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (K:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2b9pk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9pk1 a.4.7.1 (K:71-140) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

SCOPe Domain Coordinates for d2b9pk1:

Click to download the PDB-style file with coordinates for d2b9pk1.
(The format of our PDB-style files is described here.)

Timeline for d2b9pk1: