Lineage for d2b9on1 (2b9o N:2-61)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065744Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1065745Protein Ribosomal protein S14 [57753] (2 species)
  7. 1065771Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1065814Domain d2b9on1: 2b9o N:2-61 [128176]
    Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1
    automatically matched to d1fjgn_
    protein/RNA complex

Details for d2b9on1

PDB Entry: 2b9o (more details), 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2b9on1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9on1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2b9on1:

Click to download the PDB-style file with coordinates for d2b9on1.
(The format of our PDB-style files is described here.)

Timeline for d2b9on1: