Class a: All alpha proteins [46456] (284 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
Domain d2b9om1: 2b9o M:2-126 [128175] Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1 automatically matched to d1fjgm_ protein/RNA complex |
PDB Entry: 2b9o (more details), 6.46 Å
SCOPe Domain Sequences for d2b9om1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9om1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d2b9om1: