Lineage for d2b9oh1 (2b9o H:1-138)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928172Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1928173Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 1928174Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1928175Protein Ribosomal protein S8 [56049] (4 species)
  7. 1928193Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 1928238Domain d2b9oh1: 2b9o H:1-138 [128170]
    Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1
    protein/RNA complex
    protein/RNA complex

Details for d2b9oh1

PDB Entry: 2b9o (more details), 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2b9oh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9oh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2b9oh1:

Click to download the PDB-style file with coordinates for d2b9oh1.
(The format of our PDB-style files is described here.)

Timeline for d2b9oh1: