Lineage for d2b9og1 (2b9o G:2-156)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740240Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1740241Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1740242Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1740243Protein Ribosomal protein S7 [47975] (4 species)
  7. 1740273Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1740317Domain d2b9og1: 2b9o G:2-156 [128169]
    Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1
    protein/RNA complex
    protein/RNA complex

Details for d2b9og1

PDB Entry: 2b9o (more details), 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2b9og1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9og1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2b9og1:

Click to download the PDB-style file with coordinates for d2b9og1.
(The format of our PDB-style files is described here.)

Timeline for d2b9og1: