Lineage for d2b9oe1 (2b9o E:74-154)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891700Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1891745Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 1891773Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 1891807Domain d2b9oe1: 2b9o E:74-154 [128166]
    Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1
    protein/RNA complex
    protein/RNA complex

Details for d2b9oe1

PDB Entry: 2b9o (more details), 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2b9oe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9oe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d2b9oe1:

Click to download the PDB-style file with coordinates for d2b9oe1.
(The format of our PDB-style files is described here.)

Timeline for d2b9oe1: