Lineage for d2b9od1 (2b9o D:2-209)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1030835Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1030836Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1030837Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 1030838Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 1030869Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 1030912Domain d2b9od1: 2b9o D:2-209 [128165]
    Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1
    automatically matched to d1hnwd_
    protein/RNA complex

Details for d2b9od1

PDB Entry: 2b9o (more details), 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2b9od1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9od1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d2b9od1:

Click to download the PDB-style file with coordinates for d2b9od1.
(The format of our PDB-style files is described here.)

Timeline for d2b9od1: