SCOPe 2.05: Domain d2b9ob1: 2b9o B:7-240

Lineage for d2b9ob1 (2b9o B:7-240)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family)
   fold elaborated with additional structures

5. Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)

6. Protein Ribosomal protein S2 [52315] (3 species)

7. Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
   Uniprot P80371

8. Domain d2b9ob1: 2b9o B:7-240 [128162]
   Other proteins in same PDB: d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1
   protein/RNA complex
   protein/RNA complex

Details for d2b9ob1

PDB Entry: 2b9o, 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2b9ob1:

Sequence; same for both SEQRES and ATOM records:

>d2b9ob1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

Timeline for d2b9ob1:

• d2b9ob1 first appeared in SCOP 1.73
  
• d2b9ob1 appears in SCOPe 2.04
  
• d2b9ob1 appears in SCOPe 2.06
  
• d2b9ob1 appears in the current release, SCOPe 2.08