Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries) Uniprot Q72I15 2-102 |
Domain d2b9ny1: 2b9n Y:1-113 [128161] Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9nz1 automatically matched to d1ffkq_ |
PDB Entry: 2b9n (more details), 6.76 Å
SCOPe Domain Sequences for d2b9ny1:
Sequence, based on SEQRES records: (download)
>d2b9ny1 b.34.5.1 (Y:1-113) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
>d2b9ny1 b.34.5.1 (Y:1-113) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
Timeline for d2b9ny1: