SCOPe 2.02: Domain d2b9ni2: 2b9n I:1-55

Lineage for d2b9ni2 (2b9n I:1-55)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Thermus thermophilus [TaxId:274] [143636] (9 PDB entries)
   Uniprot Q5SLQ1 1-55

8. Domain d2b9ni2: 2b9n I:1-55 [128152]
   Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
   automatically matched to d1cqua_

Details for d2b9ni2

PDB Entry: 2b9n, 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.

PDB Compounds: (I:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2b9ni2:

Sequence; same for both SEQRES and ATOM records:

>d2b9ni2 d.100.1.1 (I:1-55) Ribosomal protein L9 N-domain {Thermus thermophilus [TaxId: 274]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

Timeline for d2b9ni2:

• d2b9ni2 first appeared in SCOP 1.73
  
• d2b9ni2 appears in SCOPe 2.01
  
• d2b9ni2 appears in SCOPe 2.03
  
• d2b9ni2 appears in the current release, SCOPe 2.08