Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (2 species) duplication: consists of two domains of this fold |
Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries) |
Domain d2b9nh2: 2b9n H:82-170 [128150] Other proteins in same PDB: d2b9n21, d2b9n31, d2b9nf1, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nw1, d2b9nx1, d2b9ny1 automatically matched to d1rl6a2 |
PDB Entry: 2b9n (more details), 6.76 Å
SCOP Domain Sequences for d2b9nh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9nh2 d.141.1.1 (H:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg elaaniravrppepykgkgiryegelvrl
Timeline for d2b9nh2: