SCOP 1.73: Domain d2b9nh1: 2b9n H:7-81

Lineage for d2b9nh1 (2b9n H:7-81)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)
   duplication: consists of two domains of this fold

7. Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries)

8. Domain d2b9nh1: 2b9n H:7-81 [128149]
   Other proteins in same PDB: d2b9n21, d2b9n31, d2b9nf1, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nw1, d2b9nx1, d2b9ny1
   automatically matched to d1rl6a1

Details for d2b9nh1

PDB Entry: 2b9n, 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.

PDB Compounds: (H:) 50S ribosomal protein L6

SCOP Domain Sequences for d2b9nh1:

Sequence; same for both SEQRES and ATOM records:

>d2b9nh1 d.141.1.1 (H:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskg

Timeline for d2b9nh1:

• d2b9nh1 is new in SCOP 1.73
  
• d2b9nh1 appears in SCOP 1.75
  
• d2b9nh1 appears in the current release, SCOPe 2.08