Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries) Uniprot P80374 |
Domain d2b9mi1: 2b9m I:2-128 [128134] Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1, d2b9mu1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9m (more details), 6.76 Å
SCOPe Domain Sequences for d2b9mi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9mi1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d2b9mi1: