Lineage for d2b9mh1 (2b9m H:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978267Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2978268Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2978269Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2978270Protein Ribosomal protein S8 [56049] (4 species)
  7. 2978288Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2978335Domain d2b9mh1: 2b9m H:1-138 [128133]
    Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1, d2b9mu1
    protein/RNA complex
    protein/RNA complex

Details for d2b9mh1

PDB Entry: 2b9m (more details), 6.76 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex. This file contains the 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF2 and is described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2b9mh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9mh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2b9mh1:

Click to download the PDB-style file with coordinates for d2b9mh1.
(The format of our PDB-style files is described here.)

Timeline for d2b9mh1: