Lineage for d2b8ke1 (2b8k E:2-143)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835443Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 835824Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 835825Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)
  6. 835826Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)
  7. 835827Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 835849Domain d2b8ke1: 2b8k E:2-143 [128081]
    Other proteins in same PDB: d2b8ka1, d2b8kb1, d2b8kc1, d2b8kc2, d2b8kd1, d2b8ke2, d2b8kf1, d2b8kg1, d2b8kg2, d2b8kh1, d2b8ki1, d2b8ki2, d2b8kj1, d2b8kk1, d2b8kl1
    automatically matched to d1i3qe1
    complexed with zn

Details for d2b8ke1

PDB Entry: 2b8k (more details), 4.15 Å

PDB Description: 12-subunit RNA Polymerase II
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2b8ke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8ke1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

SCOP Domain Coordinates for d2b8ke1:

Click to download the PDB-style file with coordinates for d2b8ke1.
(The format of our PDB-style files is described here.)

Timeline for d2b8ke1: