Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins) N-terminal all-beta domain defines family |
Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species) |
Species Thermoanaerobacter brockii [TaxId:29323] [51744] (4 PDB entries) |
Domain d2b83c2: 2b83 C:140-313 [128064] Other proteins in same PDB: d2b83a1, d2b83b1, d2b83c1, d2b83d1 automatically matched to d1bxza2 complexed with zn; mutant |
PDB Entry: 2b83 (more details), 2.25 Å
SCOP Domain Sequences for d2b83c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b83c2 c.2.1.1 (C:140-313) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]} mplenavmitdmmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgs rpicveaakfygatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpg giisninyhgsgdalliprvewgcgmahktikgglcpggrlraemlrdmvvynr
Timeline for d2b83c2: