Lineage for d2b83c2 (2b83 C:140-313)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819420Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 819619Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 819633Species Thermoanaerobacter brockii [TaxId:29323] [51744] (4 PDB entries)
  8. 819636Domain d2b83c2: 2b83 C:140-313 [128064]
    Other proteins in same PDB: d2b83a1, d2b83b1, d2b83c1, d2b83d1
    automatically matched to d1bxza2
    complexed with zn; mutant

Details for d2b83c2

PDB Entry: 2b83 (more details), 2.25 Å

PDB Description: a single amino acid substitution in the clostridium beijerinckii alcohol dehydrogenase is critical for thermostabilization
PDB Compounds: (C:) NADP-dependent alcohol dehydrogenase

SCOP Domain Sequences for d2b83c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b83c2 c.2.1.1 (C:140-313) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
mplenavmitdmmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgs
rpicveaakfygatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpg
giisninyhgsgdalliprvewgcgmahktikgglcpggrlraemlrdmvvynr

SCOP Domain Coordinates for d2b83c2:

Click to download the PDB-style file with coordinates for d2b83c2.
(The format of our PDB-style files is described here.)

Timeline for d2b83c2: