SCOPe 2.06: Domain d2b7dt1: 2b7d T:6-106

Lineage for d2b7dt1 (2b7d T:6-106)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
   Uniprot P13726 33-242

8. Domain d2b7dt1: 2b7d T:6-106 [128034]
   Other proteins in same PDB: d2b7dh_, d2b7dl1, d2b7dl2
   automated match to d1o5dt1
   complexed with c1b

Details for d2b7dt1

PDB Entry: 2b7d, 2.24 Å

PDB Description: factor viia inhibitors: chemical optimization, preclinical pharmacokinetics, pharmacodynamics, and efficacy in a baboon thrombosis model

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2b7dt1:

Sequence; same for both SEQRES and ATOM records:

>d2b7dt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Timeline for d2b7dt1:

• d2b7dt1 first appeared in SCOP 1.73
  
• d2b7dt1 appears in SCOPe 2.05
  
• d2b7dt1 appears in SCOPe 2.07
  
• d2b7dt1 appears in the current release, SCOPe 2.08