Class b: All beta proteins [48724] (176 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species) eukaryotic and archaeal homologue of EF-Tu |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (6 PDB entries) |
Domain d2b7ba2: 2b7b A:335-441 [128028] Other proteins in same PDB: d2b7ba1, d2b7ba3, d2b7bb1 automated match to d1f60a2 complexed with gdp; mutant |
PDB Entry: 2b7b (more details), 2.6 Å
SCOPe Domain Sequences for d2b7ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7ba2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk
Timeline for d2b7ba2: