SCOPe 2.03: Domain d2b7ba2: 2b7b A:335-441

Lineage for d2b7ba2 (2b7b A:335-441)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (6 PDB entries)

8. Domain d2b7ba2: 2b7b A:335-441 [128028]
   Other proteins in same PDB: d2b7ba1, d2b7ba3, d2b7bb1
   automated match to d1f60a2
   complexed with gdp; mutant

Details for d2b7ba2

PDB Entry: 2b7b, 2.6 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a and gdp

PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d2b7ba2:

Sequence; same for both SEQRES and ATOM records:

>d2b7ba2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk

Timeline for d2b7ba2:

• d2b7ba2 first appeared in SCOP 1.73
  
• d2b7ba2 appears in SCOPe 2.02
  
• d2b7ba2 appears in SCOPe 2.04
  
• d2b7ba2 appears in the current release, SCOPe 2.08