SCOPe 2.04: Domain d2b76b1: 2b76 B:106-243

Lineage for d2b76b1 (2b76 B:106-243)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Fumarate reductase [46550] (3 species)

7. Species Escherichia coli [TaxId:562] [46551] (6 PDB entries)

8. Domain d2b76b1: 2b76 B:106-243 [128012]
   Other proteins in same PDB: d2b76a1, d2b76a2, d2b76a3, d2b76b2, d2b76c1, d2b76d1, d2b76m1, d2b76m2, d2b76m3, d2b76n2, d2b76o1, d2b76p1
   automatically matched to d1kf6b1
   complexed with f3s, fad, fes, flc, mq7, sf4; mutant

Details for d2b76b1

PDB Entry: 2b76, 3.3 Å

PDB Description: e. coli quinol fumarate reductase frda e49q mutation

PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d2b76b1:

Sequence; same for both SEQRES and ATOM records:

>d2b76b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

Timeline for d2b76b1:

• d2b76b1 first appeared in SCOP 1.73
  
• d2b76b1 appears in SCOPe 2.03
  
• d2b76b1 appears in SCOPe 2.05
  
• d2b76b1 appears in the current release, SCOPe 2.08