Lineage for d2b66o1 (2b66 O:1-122)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798561Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 798562Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 798563Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 798564Protein Ribosomal protein L14 [50195] (5 species)
  7. 798608Species Bacillus stearothermophilus [TaxId:1422] [50196] (5 PDB entries)
  8. 798611Domain d2b66o1: 2b66 O:1-122 [127964]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1
    automatically matched to d1whi__

Details for d2b66o1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (O:) 50S ribosomal protein L14

SCOP Domain Sequences for d2b66o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b66o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]}
miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
vi

SCOP Domain Coordinates for d2b66o1:

Click to download the PDB-style file with coordinates for d2b66o1.
(The format of our PDB-style files is described here.)

Timeline for d2b66o1: