Lineage for d2b66h2 (2b66 H:82-170)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734251Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 734252Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 734253Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 734254Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 734336Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries)
  8. 734342Domain d2b66h2: 2b66 H:82-170 [127958]
    Other proteins in same PDB: d2b6621, d2b6631, d2b66f1, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66w1, d2b66x1, d2b66y1
    automatically matched to d1rl6a2

Details for d2b66h2

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (H:) 50S ribosomal protein L6

SCOP Domain Sequences for d2b66h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b66h2 d.141.1.1 (H:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg
elaaniravrppepykgkgiryegelvrl

SCOP Domain Coordinates for d2b66h2:

Click to download the PDB-style file with coordinates for d2b66h2.
(The format of our PDB-style files is described here.)

Timeline for d2b66h2: