Lineage for d2b64r1 (2b64 R:16-88)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907572Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 907573Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 907574Protein Ribosomal protein S18 [46913] (2 species)
  7. 907600Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 907645Domain d2b64r1: 2b64 R:16-88 [127950]
    Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64d1, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64o1, d2b64p1, d2b64q1, d2b64s1, d2b64t1, d2b64u1
    automatically matched to d1i94r_
    protein/RNA complex

Details for d2b64r1

PDB Entry: 2b64 (more details), 5.9 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex. This file contains the 30S subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF1 and is described in remark 400.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2b64r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b64r1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d2b64r1:

Click to download the PDB-style file with coordinates for d2b64r1.
(The format of our PDB-style files is described here.)

Timeline for d2b64r1: