Class a: All alpha proteins [46456] (258 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) |
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
Protein Ribosomal protein S15 [47065] (2 species) |
Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) |
Domain d2b64o1: 2b64 O:2-89 [127947] Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64d1, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64p1, d2b64q1, d2b64r1, d2b64s1, d2b64t1 automatically matched to d1ab3__ complexed with psu, yyg |
PDB Entry: 2b64 (more details), 5.9 Å
SCOP Domain Sequences for d2b64o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b64o1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d2b64o1: