Lineage for d2b64n1 (2b64 N:2-61)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892700Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 892701Protein Ribosomal protein S14 [57753] (2 species)
  7. 892727Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 892770Domain d2b64n1: 2b64 N:2-61 [127946]
    Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64d1, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64o1, d2b64p1, d2b64q1, d2b64r1, d2b64s1, d2b64t1, d2b64u1
    automatically matched to d1fjgn_
    complexed with psu, yyg

Details for d2b64n1

PDB Entry: 2b64 (more details), 5.9 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex. This file contains the 30S subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF1 and is described in remark 400.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d2b64n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b64n1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d2b64n1:

Click to download the PDB-style file with coordinates for d2b64n1.
(The format of our PDB-style files is described here.)

Timeline for d2b64n1: