SCOP 1.73: Domain d2b64n1: 2b64 N:2-61

Lineage for d2b64n1 (2b64 N:2-61)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)

8. Domain d2b64n1: 2b64 N:2-61 [127946]
   Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64d1, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64o1, d2b64p1, d2b64q1, d2b64r1, d2b64s1, d2b64t1
   automatically matched to d1fjgn_
   complexed with psu, yyg

Details for d2b64n1

PDB Entry: 2b64, 5.9 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex. This file contains the 30S subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF1 and is described in remark 400.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d2b64n1:

Sequence; same for both SEQRES and ATOM records:

>d2b64n1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2b64n1:

• d2b64n1 is new in SCOP 1.73
  
• d2b64n1 appears in SCOP 1.75
  
• d2b64n1 appears in the current release, SCOPe 2.08