Lineage for d2b64e2 (2b64 E:5-73)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859886Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 859887Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 859959Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 859960Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 859988Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
    Uniprot P27152
  8. 860022Domain d2b64e2: 2b64 E:5-73 [127937]
    Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64d1, d2b64e1, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64o1, d2b64p1, d2b64q1, d2b64r1, d2b64s1, d2b64t1, d2b64u1
    automatically matched to d1i94e2
    complexed with psu, yyg

Details for d2b64e2

PDB Entry: 2b64 (more details), 5.9 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex. This file contains the 30S subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF1 and is described in remark 400.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d2b64e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b64e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d2b64e2:

Click to download the PDB-style file with coordinates for d2b64e2.
(The format of our PDB-style files is described here.)

Timeline for d2b64e2: