Lineage for d2b64e1 (2b64 E:74-154)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537230Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2537278Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 2537306Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 2537341Domain d2b64e1: 2b64 E:74-154 [127936]
    Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64d1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64o1, d2b64p1, d2b64q1, d2b64r1, d2b64s1, d2b64t1, d2b64u1
    protein/RNA complex
    protein/RNA complex

Details for d2b64e1

PDB Entry: 2b64 (more details), 5.9 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex. This file contains the 30S subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF1 and is described in remark 400.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2b64e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b64e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d2b64e1:

Click to download the PDB-style file with coordinates for d2b64e1.
(The format of our PDB-style files is described here.)

Timeline for d2b64e1: