SCOP 1.73: Domain d2b64d1: 2b64 D:2-209

Lineage for d2b64d1 (2b64 D:2-209)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
   has a RRF/tRNA synthetase additional domain-like fold

6. Protein Ribosomal protein S4 [55179] (2 species)
   also contains a Zn-binding N-terminal subdomain

7. Species Thermus thermophilus [TaxId:274] [55180] (36 PDB entries)

8. Domain d2b64d1: 2b64 D:2-209 [127935]
   Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64o1, d2b64p1, d2b64q1, d2b64r1, d2b64s1, d2b64t1
   automatically matched to d1hnwd_
   complexed with psu, yyg

Details for d2b64d1

PDB Entry: 2b64, 5.9 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex. This file contains the 30S subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF1 and is described in remark 400.

PDB Compounds: (D:) 30S ribosomal protein S4

SCOP Domain Sequences for d2b64d1:

Sequence; same for both SEQRES and ATOM records:

>d2b64d1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

Timeline for d2b64d1:

• d2b64d1 is new in SCOP 1.73
  
• d2b64d1 appears in SCOP 1.75
  
• d2b64d1 appears in the current release, SCOPe 2.08