Lineage for d2b63g1 (2b63 G:1-79)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 898089Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 898090Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 898091Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 898092Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 898093Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 898125Domain d2b63g1: 2b63 G:1-79 [127925]
    Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c1, d2b63c2, d2b63e1, d2b63e2, d2b63f1, d2b63h1, d2b63i1, d2b63i2, d2b63j1, d2b63k1, d2b63l1
    low resulution structure
    complexed with 5bu, mg, zn

Details for d2b63g1

PDB Entry: 2b63 (more details), 3.8 Å

PDB Description: Complete RNA Polymerase II-RNA inhibitor complex
PDB Compounds: (G:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOP Domain Sequences for d2b63g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b63g1 i.8.1.1 (G:1-79) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvf

SCOP Domain Coordinates for d2b63g1:

Click to download the PDB-style file with coordinates for d2b63g1.
(The format of our PDB-style files is described here.)

Timeline for d2b63g1: