Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (4 PDB entries) Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337 |
Domain d2b4to1: 2b4t O:4-152,O:319-335 [127856] Other proteins in same PDB: d2b4to2, d2b4to3, d2b4tp2, d2b4tp3, d2b4tq2, d2b4tq3, d2b4tr2, d2b4tr3 automated match to d2b4ro1 complexed with aes, nad |
PDB Entry: 2b4t (more details), 2.5 Å
SCOPe Domain Sequences for d2b4to1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4to1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} tklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevtha dgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvimsa ppkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhit
Timeline for d2b4to1: