Lineage for d2b4to1 (2b4t O:4-152,O:319-335)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 820760Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 820964Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 821090Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (3 PDB entries)
    Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337
  8. 821095Domain d2b4to1: 2b4t O:4-152,O:319-335 [127856]
    Other proteins in same PDB: d2b4to2, d2b4tp2, d2b4tq2, d2b4tr2
    automatically matched to 2B4R O:4-152,O:319-335
    complexed with aes, nad; mutant

Details for d2b4to1

PDB Entry: 2b4t (more details), 2.5 Å

PDB Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum at 2.25 Angstrom resolution reveals intriguing extra electron density in the active site
PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d2b4to1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4to1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
tklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevtha
dgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvimsa
ppkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhit

SCOP Domain Coordinates for d2b4to1:

Click to download the PDB-style file with coordinates for d2b4to1.
(The format of our PDB-style files is described here.)

Timeline for d2b4to1: