Lineage for d2b4sd_ (2b4s D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673174Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 1673175Species Human (Homo sapiens) [TaxId:9606] [56163] (16 PDB entries)
  8. 1673187Domain d2b4sd_: 2b4s D: [127855]
    Other proteins in same PDB: d2b4sa_, d2b4sc_
    automated match to d1p14a_
    complexed with so4

Details for d2b4sd_

PDB Entry: 2b4s (more details), 2.3 Å

PDB Description: Crystal structure of a complex between PTP1B and the insulin receptor tyrosine kinase
PDB Compounds: (D:) Insulin receptor

SCOPe Domain Sequences for d2b4sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4sd_ d.144.1.7 (D:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

SCOPe Domain Coordinates for d2b4sd_:

Click to download the PDB-style file with coordinates for d2b4sd_.
(The format of our PDB-style files is described here.)

Timeline for d2b4sd_: