Lineage for d2b4rp2 (2b4r P:153-318)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915812Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1915900Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143536] (3 PDB entries)
    Uniprot Q8IKK7 153-318! Uniprot Q8T6B1 153-318
  8. 1915902Domain d2b4rp2: 2b4r P:153-318 [127848]
    Other proteins in same PDB: d2b4ro1, d2b4rp1, d2b4rq1, d2b4rr1
    automated match to d2b4ro2
    complexed with aes, gol, nad

Details for d2b4rp2

PDB Entry: 2b4r (more details), 2.25 Å

PDB Description: crystal structure of glyceraldehyde-3-phosphate dehydrogenase from plasmodium falciparum at 2.25 angstrom resolution reveals intriguing extra electron density in the active site
PDB Compounds: (P:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2b4rp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4rp2 d.81.1.1 (P:153-318) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdwragrcalsniipa
stgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegp
lkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswyd

SCOPe Domain Coordinates for d2b4rp2:

Click to download the PDB-style file with coordinates for d2b4rp2.
(The format of our PDB-style files is described here.)

Timeline for d2b4rp2: